ZNF101 Antibody

Name ZNF101 Antibody
Supplier Novus Biologicals
Catalog NBP1-68923
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZNF101 (zinc finger protein 101) The peptide sequence was selected from the N terminal of ZNF101. Peptide sequence EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF101
Conjugate Unconjugated
Supplier Page Shop

Product images