CEACAM7 Antibody

Name CEACAM7 Antibody
Supplier Novus Biologicals
Catalog NBP1-68887
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CEACAM7 (carcinoembryonic antigen-related cell adhesion molecule 7) The peptide sequence was selected from the N terminal of CEACAM7. Peptide sequence NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEACAM7
Conjugate Unconjugated
Supplier Page Shop

Product images