CABP4 Antibody

Name CABP4 Antibody
Supplier Novus Biologicals
Catalog NBP1-68995
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CABP4 (calcium binding protein 4) The peptide sequence was selected from the N terminal of CABP4. Peptide sequence PSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CABP4
Conjugate Unconjugated
Supplier Page Shop

Product images