OR2H1 Antibody

Name OR2H1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69053
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR2H1 (olfactory receptor, family 2, subfamily H, member 1) The peptide sequence was selected from the C terminal of OR2H1. Peptide sequence IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene OR2H1
Supplier Page Shop

Product images