OR2L3 Antibody

Name OR2L3 Antibody
Supplier Novus Biologicals
Catalog NBP1-69050
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR2L3 (olfactory receptor, family 2, subfamily L, member 3) The peptide sequence was selected from the C terminal of OR2L3. Peptide sequence KSAEGRKKAYLTCSTHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR2L8
Conjugate Unconjugated
Supplier Page Shop

Product images