OR2T29 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69037
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to OR2T29 (olfactory receptor, family 2, subfamily T, member 29) The peptide sequence was selected from the C terminal of OR2T29. Peptide sequence GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: OR2T29
• Conjugate: Unconjugated