MAGEA11 Antibody

Name MAGEA11 Antibody
Supplier Novus Biologicals
Catalog NBP1-69034
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEA11 (melanoma antigen family A, 11) The peptide sequence was selected from the middle region of MAGEA11. Peptide sequence FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEA11
Conjugate Unconjugated
Supplier Page Shop

Product images