OR1L8 Antibody

Name OR1L8 Antibody
Supplier Novus Biologicals
Catalog NBP1-69091
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR1L8 (olfactory receptor, family 1, subfamily L, member 8) The peptide sequence was selected from the C terminal of OR1L8. Peptide sequence MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR1L8
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.