OR1S1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69090
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to OR1S1 (olfactory receptor, family 1, subfamily S, member 1) The peptide sequence was selected from the C terminal of OR1S1. Peptide sequence FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: OR1S1
• Conjugate: Unconjugated