SLC39A2/ZIP2 Antibody
| Name | SLC39A2/ZIP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69503 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC39A2/ZIP2(solute carrier family 39 (zinc transporter), member 2) The peptide sequence was selected from the N terminal of SLC39A2/ZIP2. Peptide sequence EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A2 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC39A2/ZIP2 Antibody [NBP1-69503] - SLC39A2/ZIP2 Antibody [NBP1-69503] - This Anti-SLC39A2 antibody was used in Western Blot of PANC1 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/442_SLC39A2-ZIP2-Antibody-Western-Blot-NBP1-69503-img0002.jpg)
Western Blot: SLC39A2/ZIP2 Antibody [NBP1-69503] - SLC39A2/ZIP2 Antibody [NBP1-69503] - This Anti-SLC39A2 antibody was used in Western Blot of PANC1 tissue lysate at a concentration of 1ug/ml.