Porimin Antibody
| Name | Porimin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69491 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM123(transmembrane protein 123) The peptide sequence was selected from the C terminal of TMEM123. Peptide sequence SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM123 |
| Supplier Page | Shop |
Product images
![Western Blot: PORIMIN Antibody [NBP1-69491] - This Anti-TMEM123 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/444_PORIMIN%2520Antibody-Western%2520Blot-NBP1-69491-img0001.jpg)
Western Blot: PORIMIN Antibody [NBP1-69491] - This Anti-TMEM123 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.