C10orf57 Antibody
| Name | C10orf57 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69342 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C10ORF57 The peptide sequence was selected from the middle region of C10ORF57. Peptide sequence QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM254 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C10orf57 Antibody [NBP1-69342] - This Anti-C10orf57 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15102_C10orf57%2520Antibody-Western%2520Blot-NBP1-69342-img0001.jpg)
Western Blot: C10orf57 Antibody [NBP1-69342] - This Anti-C10orf57 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.