ZP4 Antibody
| Name | ZP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69341 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ZP4(zona pellucida glycoprotein 4) The peptide sequence was selected from the N terminal of ZP4. Peptide sequence MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZP4 Antibody [NBP1-69341] - This Anti-ZP4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6965_ZP4-Antibody-Western-Blot-NBP1-69341-img0001.jpg)
![Western Blot: ZP4 Antibody [NBP1-69341] - recombinant human ZP4 protein.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6966_ZP4%2520Antibody-Western%2520Blot-NBP1-69341-img0002.jpg)