Tetraspanin-31 Antibody
| Name | Tetraspanin-31 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69339 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TSPAN31(tetraspanin 31) The peptide sequence was selected from the middle region of TSPAN31. Peptide sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSPAN31 |
| Supplier Page | Shop |
Product images
![Western Blot: Tetraspanin-31 Antibody [NBP1-69339] - This Anti-TSPAN31 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5674_Tetraspanin-31-Antibody-Western-Blot-NBP1-69339-img0002.jpg)
Western Blot: Tetraspanin-31 Antibody [NBP1-69339] - This Anti-TSPAN31 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.