Name | LIM2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69325 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to LIM2(lens intrinsic membrane protein 2, 19kDa) The peptide sequence was selected from the N terminal of LIM2. Peptide sequence GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | LIM2 |
Conjugate | Unconjugated |
Supplier Page | Shop |