ADAM30 Antibody
| Name | ADAM30 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69319 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ADAM30 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ADAM30 Antibody [NBP1-69319] - This Anti-ADAM30 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15209_ADAM30%2520Antibody-Western%2520Blot-NBP1-69319-img0001.jpg)
Western Blot: ADAM30 Antibody [NBP1-69319] - This Anti-ADAM30 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.