PILR-beta Antibody
| Name | PILR-beta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69382 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PILRB(paired immunoglobin-like type 2 receptor beta) The peptide sequence was selected from the middle region of PILRB. Peptide sequence KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PILRB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PILRB Antibody [NBP1-69382] - This Anti-PILRB antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15077_PILRB%2520Antibody-Western%2520Blot-NBP1-69382-img0001.jpg)
Western Blot: PILRB Antibody [NBP1-69382] - This Anti-PILRB antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.