TBL2 Antibody
| Name | TBL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69369 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TBL2(transducin (beta)-like 2) The peptide sequence was selected from the N terminal of TBL2. Peptide sequence RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TBL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TBL2 Antibody [NBP1-69369] - This Anti-TBL2 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16669_TBL2%2520Antibody-Western%2520Blot-NBP1-69369-img0001.jpg)
Western Blot: TBL2 Antibody [NBP1-69369] - This Anti-TBL2 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.