ADAM7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69366
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ADAM7(ADAM metallopeptidase domain 7) The peptide sequence was selected from the C terminal of ADAM7. Peptide sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ADAM7
• Conjugate: Unconjugated