BTNL3 Antibody
| Name | BTNL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69346 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to BTNL3(butyrophilin-like 3) The peptide sequence was selected from the N terminal of BTNL3. Peptide sequence EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BTNL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24256_BTNL3-Antibody-Western-Blot-NBP1-69346-img0003.jpg)
Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml
![Western Blot: BTNL3 Antibody [NBP1-69346] - This Anti-BTNL3 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24257_BTNL3-Antibody-Western-Blot-NBP1-69346-img0001.jpg)
Western Blot: BTNL3 Antibody [NBP1-69346] - This Anti-BTNL3 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.
![Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24258_BTNL3-Antibody-Western-Blot-NBP1-69346-img0002.jpg)
Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml