UGT3A2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69422
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to UGT3A2(UDP glycosyltransferase 3 family, polypeptide A2) The peptide sequence was selected from the middle region of UGT3A2. Peptide sequence RYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWH.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: UGT3A2
• Conjugate: Unconjugated