FCRL4/FcRH4/IRTA1 Antibody

Name FCRL4/FcRH4/IRTA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69383
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FCRL4(Fc receptor-like 4) The peptide sequence was selected from the N terminal of FCRL4. Peptide sequence FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FCRL4
Conjugate Unconjugated
Supplier Page Shop

Product images