PAGE4 Antibody

Name PAGE4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57080
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PAGE4 (P antigen family, member 4 (prostate associated)) The peptide sequence was selected from the middle region of PAGE4. Peptide sequence PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PAGE4
Conjugate Unconjugated
Supplier Page Shop

Product images