Name | GLIPR1L1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57060 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GLIPR1L1 (GLI pathogenesis-related 1 like 1) The peptide sequence was selected from the middle region of GLIPR1L1. Peptide sequence NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | GLIPR1L1 |
Conjugate | Unconjugated |
Supplier Page | Shop |