GLIPR1L1 Antibody

Name GLIPR1L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57060
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GLIPR1L1 (GLI pathogenesis-related 1 like 1) The peptide sequence was selected from the middle region of GLIPR1L1. Peptide sequence NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GLIPR1L1
Conjugate Unconjugated
Supplier Page Shop

Product images