MAGEA5 Antibody

Name MAGEA5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57055
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEA5 (melanoma antigen family A, 5) The peptide sequence was selected from the N terminal of MAGEA5. Peptide sequence MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEA5
Conjugate Unconjugated
Supplier Page Shop

Product images