ERMN Antibody

Name ERMN Antibody
Supplier Novus Biologicals
Catalog NBP1-56953
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA1189 The peptide sequence was selected from the middle region of KIAA1189. Peptide sequence RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ERMN
Conjugate Unconjugated
Supplier Page Shop

Product images