IQCD Antibody

Name IQCD Antibody
Supplier Novus Biologicals
Catalog NBP1-56946
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IQCD(IQ motif containing D) The peptide sequence was selected from the N terminal of IQCD. Peptide sequence ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IQCD
Conjugate Unconjugated
Supplier Page Shop

Product images