IQCD Antibody

Name IQCD Antibody
Supplier Novus Biologicals
Catalog NBP1-56941
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IQCD (IQ motif containing D) The peptide sequence was selected from the middle region of IQCD. Peptide sequence CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IQCD
Conjugate Unconjugated
Supplier Page Shop

Product images