C6orf154 Antibody
| Name | C6orf154 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56940 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human C6orf154 (NP_001012992). Peptide sequence MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC73 |
| Supplier Page | Shop |
Product images
![Western Blot: C6orf154 Antibody [NBP1-56940] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/502_C6orf154%2520Antibody-Western%2520Blot-NBP1-56940-img0002.jpg)
Western Blot: C6orf154 Antibody [NBP1-56940] - 293T cells lysate, concentration 0.2-1 ug/ml.