C18orf56 Antibody

Name C18orf56 Antibody
Supplier Novus Biologicals
Catalog NBP1-57050
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C18orf56 (chromosome 18 open reading frame 56) The peptide sequence was selected from the N terminal of C18orf56. Peptide sequence MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TYMSOS
Conjugate Unconjugated
Supplier Page Shop

Product images