Name | C18orf56 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57050 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to C18orf56 (chromosome 18 open reading frame 56) The peptide sequence was selected from the N terminal of C18orf56. Peptide sequence MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TYMSOS |
Conjugate | Unconjugated |
Supplier Page | Shop |