TBC1D26 Antibody
| Name | TBC1D26 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57658 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MGC51025 The peptide sequence was selected from the middle region of MGC51025. Peptide sequence RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TBC1D26 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TBC1D26 Antibody [NBP1-57658] - Human kidney lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17063_TBC1D26-Antibody-Western-Blot-NBP1-57658-img0003.jpg)
Western Blot: TBC1D26 Antibody [NBP1-57658] - Human kidney lysate, concentration 0.2-1 ug/ml.