Galectin-14/LGALS14 Antibody

Name Galectin-14/LGALS14 Antibody
Supplier Novus Biologicals
Catalog NBP1-57683
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LGALS14(lectin, galactoside-binding, soluble, 14) The peptide sequence was selected from the N terminal of LGALS14. Peptide sequence MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LGALS14
Conjugate Unconjugated
Supplier Page Shop

Product images