Glutamate Dehydrogenase 2/GLUD2 Antibody
| Name | Glutamate Dehydrogenase 2/GLUD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57732 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GLUD2 (glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2)(50ug). Peptide sequence EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GLUD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glutamate Dehydrogenase 2/GLUD2 Antibody [NBP1-57732] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15891_Glutamate-Dehydrogenase-2-GLUD2-Antibody-Western-Blot-NBP1-57732-img0003.jpg)
Western Blot: Glutamate Dehydrogenase 2/GLUD2 Antibody [NBP1-57732] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.