C20orf132 Antibody

Name C20orf132 Antibody
Supplier Novus Biologicals
Catalog NBP1-57772
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C20orf132 (chromosome 20 open reading frame 132) The peptide sequence was selected from the middle region of C20orf132)(50ug). Peptide sequence PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MROH8
Conjugate Unconjugated
Supplier Page Shop

Product images