FAM216B Antibody
| Name | FAM216B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57767 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FAM216B The peptide sequence was selected from the N terminal of FAM216B 50ug). Peptide sequence MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FAM216B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM216B Antibody [NBP1-57767] - FAM216B Antibody MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16578_FAM216B-Antibody-Western-Blot-NBP1-57767-img0003.jpg)
Western Blot: FAM216B Antibody [NBP1-57767] - FAM216B Antibody MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.