RAI16 Antibody

Name RAI16 Antibody
Supplier Novus Biologicals
Catalog NBP1-57748
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAI16 (family with sequence similarity 160, member B2) The peptide sequence was selected from the N terminal of RAI16)(50ug). Peptide sequence HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM160B2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.