ILDR1 Antibody
| Name | ILDR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69697 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ILDR1(immunoglobulin-like domain containing receptor 1) The peptide sequence was selected from the middle region of ILDR1. Peptide sequence RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ILDR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ILDR1 Antibody [NBP1-69697] - This Anti-ILDR1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15032_ILDR1%2520Antibody-Western%2520Blot-NBP1-69697-img0001.jpg)
Western Blot: ILDR1 Antibody [NBP1-69697] - This Anti-ILDR1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.