Soggy-1/DkkL1 Antibody
| Name | Soggy-1/DkkL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69688 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DKKL1(dickkopf-like 1 (soggy)) The peptide sequence was selected from the C terminal of DKKL1. Peptide sequence DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DKKL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DKKL1 Antibody [NBP1-69688] - This Anti-DKKL1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16515_DKKL1%2520Antibody-Western%2520Blot-NBP1-69688-img0001.jpg)
Western Blot: DKKL1 Antibody [NBP1-69688] - This Anti-DKKL1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.