DHRS7B Antibody
| Name | DHRS7B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69584 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DHRS7B(dehydrogenase/reductase (SDR family) member 7B) The peptide sequence was selected from the middle region of DHRS7B. Peptide sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DHRS7B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DHRS7B Antibody [NBP1-69584] - This Anti-DHRS7B antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16526_DHRS7B%2520Antibody-Western%2520Blot-NBP1-69584-img0001.jpg)
Western Blot: DHRS7B Antibody [NBP1-69584] - This Anti-DHRS7B antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.