Aquaporin-10 Antibody
| Name | Aquaporin-10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69625 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to AQP10(aquaporin 10) The peptide sequence was selected from the C terminal of AQP10. Peptide sequence VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AQP10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Aquaporin-10 Antibody [NBP1-69625] - Aquaporin-10 Antibody This Anti-AQP10 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16688_Aquaporin-10-Antibody-Western-Blot-NBP1-69625-img0002.jpg)
Western Blot: Aquaporin-10 Antibody [NBP1-69625] - Aquaporin-10 Antibody This Anti-AQP10 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.