SCUBE2 Antibody
| Name | SCUBE2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69603 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SCUBE2(signal peptide, CUB domain, EGF-like 2) The peptide sequence was selected from the C terminal of SCUBE2. Peptide sequence KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SCUBE2 |
| Supplier Page | Shop |
Product images
![Western Blot: SCUBE2 Antibody [NBP1-69603] - This Anti-SCUBE2 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/556_SCUBE2%2520Antibody-Western%2520Blot-NBP1-69603-img0001.jpg)
Western Blot: SCUBE2 Antibody [NBP1-69603] - This Anti-SCUBE2 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.