| Name | CYP2A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69676 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYP2A7(cytochrome P450, family 2, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP2A7. Peptide sequence KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYP2A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |