CYP2A7 Antibody
| Name | CYP2A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69675 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYP2A7 (cytochrome P450, family 2, subfamily A, polypeptide 7) The peptide sequence was selected from the N terminal of CYP2A7. Peptide sequence MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYP2A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CYP2A7 Antibody [NBP1-69675] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: PANC1 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15175_CYP2A7%2520Antibody-Western%2520Blot-NBP1-69675-img0001.jpg)
Western Blot: CYP2A7 Antibody [NBP1-69675] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: PANC1 cell lysate