RHCE Antibody
| Name | RHCE Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69668 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RHCE(Rh blood group, CcEe antigens) The peptide sequence was selected from the N terminal of RHCE. Peptide sequence SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RHCE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RHCE Antibody [NBP1-69668] - This Anti-RHCE antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14968_RHCE%2520Antibody-Western%2520Blot-NBP1-69668-img0001.jpg)
Western Blot: RHCE Antibody [NBP1-69668] - This Anti-RHCE antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.