RHAG Antibody
| Name | RHAG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69665 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RHAG(Rh-associated glycoprotein) The peptide sequence was selected from the middle region of RHAG. Peptide sequence FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RHAG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RHAG Antibody [NBP1-69665] - This Anti-RHAG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14980_RHAG%2520Antibody-Western%2520Blot-NBP1-69665-img0001.jpg)
Western Blot: RHAG Antibody [NBP1-69665] - This Anti-RHAG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.