Layilin Antibody

Name Layilin Antibody
Supplier Novus Biologicals
Catalog NBP1-69660
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LAYN(layilin) The peptide sequence was selected from the N terminal of LAYN. Peptide sequence CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LAYN
Conjugate Unconjugated
Supplier Page Shop

Product images