TM4SF4 Antibody
| Name | TM4SF4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69647 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TM4SF4(transmembrane 4 L six family member 4) The peptide sequence was selected from the N terminal of TM4SF4. Peptide sequence CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TM4SF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TM4SF4 Antibody [NBP1-69647] - This Anti-TM4SF4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15803_TM4SF4%2520Antibody-Western%2520Blot-NBP1-69647-img0001.jpg)
Western Blot: TM4SF4 Antibody [NBP1-69647] - This Anti-TM4SF4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.