IL-28 R alpha/IFN-lambda R1 Antibody
| Name | IL-28 R alpha/IFN-lambda R1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69636 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFNLR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IL28RA Antibody [NBP1-69636] - This Anti-IL28RA antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15293_IL28RA%2520Antibody-Western%2520Blot-NBP1-69636-img0001.jpg)
Western Blot: IL28RA Antibody [NBP1-69636] - This Anti-IL28RA antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.