| Name | IL-28 R alpha/IFN-lambda R1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69635 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFNLR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |