Name | IL-28 R alpha/IFN-lambda R1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69635 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | IFNLR1 |
Conjugate | Unconjugated |
Supplier Page | Shop |