| Name | VSIG4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69631 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to VSIG4(V-set and immunoglobulin domain containing 4) The peptide sequence was selected from the N terminal of VSIG4. Peptide sequence VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | VSIG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |